Lineage for d3exeg_ (3exe G:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361943Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1361977Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 1361978Species Human (Homo sapiens) [TaxId:9606] [89652] (5 PDB entries)
  8. 1361982Domain d3exeg_: 3exe G: [209707]
    Other proteins in same PDB: d3exeb1, d3exeb2, d3exed1, d3exed2, d3exef1, d3exef2, d3exeh1, d3exeh2
    automated match to d1ni4a_
    complexed with gol, k, mn, tpp

Details for d3exeg_

PDB Entry: 3exe (more details), 1.98 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (G:) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial

SCOPe Domain Sequences for d3exeg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exeg_ c.36.1.11 (G:) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
mfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
nmaalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrf
aaaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmvnsn
lasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfks
vs

SCOPe Domain Coordinates for d3exeg_:

Click to download the PDB-style file with coordinates for d3exeg_.
(The format of our PDB-style files is described here.)

Timeline for d3exeg_: