| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
| Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
| Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89713] (7 PDB entries) |
| Domain d3exed2: 3exe D:186-329 [209703] Other proteins in same PDB: d3exea_, d3exeb1, d3exec_, d3exed1, d3exee_, d3exef1, d3exeg_, d3exeh1 automated match to d1umdb2 complexed with gol, k, mn, tpp |
PDB Entry: 3exe (more details), 1.98 Å
SCOPe Domain Sequences for d3exed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exed2 c.48.1.2 (D:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd
metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya
kilednsipqvkdiifaikktlni
Timeline for d3exed2: