SCOPe 2.07: Domain d3exed1: 3exe D:1-185

Lineage for d3exed1 (3exe D:1-185)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)

8. Domain d3exed1: 3exe D:1-185 [209702]
   Other proteins in same PDB: d3exea1, d3exea2, d3exeb2, d3exec1, d3exec2, d3exed2, d3exee_, d3exef2, d3exeg1, d3exeg2, d3exeh2
   automated match to d1umdb1
   complexed with gol, k, mn, tpp

Details for d3exed1

PDB Entry: 3exe, 1.98 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex

PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exed1:

Sequence; same for both SEQRES and ATOM records:

>d3exed1 c.36.1.0 (D:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

Timeline for d3exed1:

• d3exed1 first appeared in SCOPe 2.03
  
• d3exed1 appears in SCOPe 2.06
  
• d3exed1 appears in the current release, SCOPe 2.08