Lineage for d3ex8d2 (3ex8 D:146-359)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511455Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
    Pfam PF01872
  6. 2511459Protein Riboflavin biosynthesis protein RibD [142702] (2 species)
  7. 2511460Species Bacillus subtilis [TaxId:1423] [142703] (4 PDB entries)
    Uniprot P17618 146-359
  8. 2511468Domain d3ex8d2: 3ex8 D:146-359 [209696]
    Other proteins in same PDB: d3ex8a1, d3ex8b1, d3ex8c1, d3ex8d1, d3ex8d3
    automated match to d2b3za1
    complexed with aif, zn

Details for d3ex8d2

PDB Entry: 3ex8 (more details), 2.56 Å

PDB Description: Complex structure of bacillus subtilis RibG reduction mechanism in riboflavin biosynthesis
PDB Compounds: (D:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d3ex8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ex8d2 c.71.1.2 (D:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

SCOPe Domain Coordinates for d3ex8d2:

Click to download the PDB-style file with coordinates for d3ex8d2.
(The format of our PDB-style files is described here.)

Timeline for d3ex8d2: