SCOPe 2.05: Domain d3ex8b2: 3ex8 B:146-359

Lineage for d3ex8b2 (3ex8 B:146-359)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
   Pfam PF01872

6. Protein Riboflavin biosynthesis protein RibD [142702] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142703] (4 PDB entries)
   Uniprot P17618 146-359

8. Domain d3ex8b2: 3ex8 B:146-359 [209692]
   Other proteins in same PDB: d3ex8a1, d3ex8b1, d3ex8c1, d3ex8d1
   automated match to d2b3za1
   complexed with aif, zn

Details for d3ex8b2

PDB Entry: 3ex8, 2.56 Å

PDB Description: Complex structure of bacillus subtilis RibG reduction mechanism in riboflavin biosynthesis

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d3ex8b2:

Sequence; same for both SEQRES and ATOM records:

>d3ex8b2 c.71.1.2 (B:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

Timeline for d3ex8b2:

• d3ex8b2 first appeared in SCOPe 2.03
  
• d3ex8b2 appears in SCOPe 2.04
  
• d3ex8b2 appears in SCOPe 2.06
  
• d3ex8b2 appears in the current release, SCOPe 2.08