SCOPe 2.05: Domain d3ex8b1: 3ex8 B:1-145

Lineage for d3ex8b1 (3ex8 B:1-145)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Riboflavin biosynthesis protein RibD [142837] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries)
   Uniprot P17618 1-145

8. Domain d3ex8b1: 3ex8 B:1-145 [209691]
   Other proteins in same PDB: d3ex8a2, d3ex8b2, d3ex8c2, d3ex8d2
   automated match to d2b3za2
   complexed with aif, zn

Details for d3ex8b1

PDB Entry: 3ex8, 2.56 Å

PDB Description: Complex structure of bacillus subtilis RibG reduction mechanism in riboflavin biosynthesis

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d3ex8b1:

Sequence; same for both SEQRES and ATOM records:

>d3ex8b1 c.97.1.2 (B:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

Timeline for d3ex8b1:

• d3ex8b1 first appeared in SCOPe 2.03
  
• d3ex8b1 appears in SCOPe 2.04
  
• d3ex8b1 appears in SCOPe 2.06
  
• d3ex8b1 appears in the current release, SCOPe 2.08