Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
Protein Riboflavin biosynthesis protein RibD [142837] (2 species) |
Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries) Uniprot P17618 1-145 |
Domain d3ex8b1: 3ex8 B:1-145 [209691] Other proteins in same PDB: d3ex8a2, d3ex8b2, d3ex8c2, d3ex8d2 automated match to d2b3za2 complexed with aif, zn |
PDB Entry: 3ex8 (more details), 2.56 Å
SCOPe Domain Sequences for d3ex8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ex8b1 c.97.1.2 (B:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie vregiladqaerlnekflhfmrtgl
Timeline for d3ex8b1: