| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins) Pfam PF01872 |
| Protein Riboflavin biosynthesis protein RibD [142702] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [142703] (4 PDB entries) Uniprot P17618 146-359 |
| Domain d3ex8a2: 3ex8 A:146-359 [209690] Other proteins in same PDB: d3ex8a1, d3ex8b1, d3ex8c1, d3ex8d1 automated match to d2b3za1 complexed with aif, zn |
PDB Entry: 3ex8 (more details), 2.56 Å
SCOPe Domain Sequences for d3ex8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ex8a2 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt
Timeline for d3ex8a2: