SCOP 1.73: Domain d1fved2: 1fve D:121-223

Lineage for d1fved2 (1fve D:121-223)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1fved2: 1fve D:121-223 [20969]
Other proteins in same PDB: d1fvea1, d1fvea2, d1fveb1, d1fvec1, d1fvec2, d1fved1
part of humanized Fab 4D5, herceptin

Details for d1fved2

PDB Entry: 1fve (more details), 2.7 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

PDB Compounds: (D:) igg1-kappa 4d5 fab (heavy chain)

SCOP Domain Sequences for d1fved2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fved2 b.1.1.2 (D:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1fved2:

Click to download the PDB-style file with coordinates for d1fved2.
(The format of our PDB-style files is described here.)

Timeline for d1fved2: