Lineage for d3ex8a1 (3ex8 A:1-145)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1627984Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1627985Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1628060Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 1628110Protein Riboflavin biosynthesis protein RibD [142837] (2 species)
  7. 1628111Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries)
    Uniprot P17618 1-145
  8. 1628120Domain d3ex8a1: 3ex8 A:1-145 [209689]
    Other proteins in same PDB: d3ex8a2, d3ex8b2, d3ex8c2, d3ex8d2
    automated match to d2b3za2
    complexed with aif, zn

Details for d3ex8a1

PDB Entry: 3ex8 (more details), 2.56 Å

PDB Description: Complex structure of bacillus subtilis RibG reduction mechanism in riboflavin biosynthesis
PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d3ex8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ex8a1 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

SCOPe Domain Coordinates for d3ex8a1:

Click to download the PDB-style file with coordinates for d3ex8a1.
(The format of our PDB-style files is described here.)

Timeline for d3ex8a1: