SCOPe 2.05: Domain d3ewma_: 3ewm A:

Lineage for d3ewma_ (3ewm A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (37 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [225557] (2 PDB entries)

8. Domain d3ewma_: 3ewm A: [209687]
   automated match to d2fv7a1

Details for d3ewma_

PDB Entry: 3ewm, 1.9 Å

PDB Description: crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii

PDB Compounds: (A:) Uncharacterized sugar kinase PH1459

SCOPe Domain Sequences for d3ewma_:

Sequence; same for both SEQRES and ATOM records:

>d3ewma_ c.72.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
sliasigellidlisveegdlkdvrlfekhpggapanvavgvsrlgvkssliskvgndpf
geylieelskenvdtrgivkdekkhtgivfvqlkgaspsfllyddvayfnmtlndinwdi
veeakivnfgsvilarnpsretvmkvikkikgssliafdvnlrldlwrgqeeemikvlee
sikladivkaseeevlylenqgvevkgsmltaitlgpkgcrliknetvvdvpsynvnpld
ttgagdafmaallvgilklkgldllklgkfanlvaalstqkrgawstprkdellkykear
evla

Timeline for d3ewma_:

• d3ewma_ first appeared in SCOPe 2.03
  
• d3ewma_ appears in SCOPe 2.04
  
• d3ewma_ is called d3ewma1 in SCOPe 2.06
  
• d3ewma_ appears in the current release, SCOPe 2.08, called d3ewma1