Lineage for d3ewaa2 (3ewa A:64-322)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114448Species Methanococcus maripaludis [TaxId:39152] [226757] (5 PDB entries)
  8. 2114449Domain d3ewaa2: 3ewa A:64-322 [209686]
    Other proteins in same PDB: d3ewaa1
    automated match to d1pzna2
    protein/DNA complex; complexed with anp, mg

Details for d3ewaa2

PDB Entry: 3ewa (more details), 2 Å

PDB Description: rada recombinase from methanococcus maripaludis in complex with amppnp and ammonium ions
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d3ewaa2:

Sequence, based on SEQRES records: (download)

>d3ewaa2 c.37.1.0 (A:64-322) automated matches {Methanococcus maripaludis [TaxId: 39152]}
fksgvellkqrqsvwrlstgsteldtvlaggiesqsvtefagmfgsgktqimhqtcvnlq
mrekifadlegvveeeleapkavyidtegtfrpervvqmaegagidgqtvldntfvaray
nsdmqmlfaekiedlikggnniklviidsltstfrneftgrgklaerqqklgrhmatlnk
ladlyncivlvtnqvaakpdayfgvaeqaigghvvghaatfrfflrkskgdkrvaklyds
phlpdseavfritekgiqd

Sequence, based on observed residues (ATOM records): (download)

>d3ewaa2 c.37.1.0 (A:64-322) automated matches {Methanococcus maripaludis [TaxId: 39152]}
fksgvellkqrqsvwrlstgsteldtvlaggiesqsvtefagmfgsgktqimhqtcvnlq
mrekifadlegvveeeleapkavyidtegtfrpervvqmaegagidgqtvldntfvaray
nsdmqmlfaekiedlikggnniklviidsltstfrneftgrgklaerqqklgrhmatlnk
ladlyncivlvtnqvaakaeqaigghvvghaatfrfflrkskgdkrvaklydsphlpdse
avfritekgiqd

SCOPe Domain Coordinates for d3ewaa2:

Click to download the PDB-style file with coordinates for d3ewaa2.
(The format of our PDB-style files is described here.)

Timeline for d3ewaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ewaa1