SCOPe 2.04: Domain d3euub_: 3euu B:

Lineage for d3euub_ (3euu B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries)

8. Domain d3euub_: 3euu B: [209674]
   automated match to d3dara1

Details for d3euub_

PDB Entry: 3euu, 2.34 Å

PDB Description: Crystal structure of the FGFR2 D2 domain

PDB Compounds: (B:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3euub_:

Sequence; same for both SEQRES and ATOM records:

>d3euub_ b.1.1.4 (B:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv

Timeline for d3euub_:

• d3euub_ first appeared in SCOPe 2.03
  
• d3euub_ appears in SCOPe 2.05
  
• d3euub_ appears in the current release, SCOPe 2.08