Lineage for d3euld_ (3eul D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (71 species)
    not a true protein
  7. 2102116Species Mycobacterium tuberculosis [TaxId:1773] [225553] (2 PDB entries)
  8. 2102120Domain d3euld_: 3eul D: [209672]
    automated match to d3h1ga_
    complexed with cl

Details for d3euld_

PDB Entry: 3eul (more details), 1.9 Å

PDB Description: Structure of the signal receiver domain of the putative response regulator NarL from Mycobacterium tuberculosis
PDB Compounds: (D:) POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL REGULATORY PROTEIN NARL (DNA-binding response regulator, LuxR family)

SCOPe Domain Sequences for d3euld_:

Sequence, based on SEQRES records: (download)

>d3euld_ c.23.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vvgddhplfregvvralslsgsvnvvgeaddgaaalelikahlpdvalldyrmpgmdgaq
vaaavrsyelptrvllisahdepaivyqalqqgaagfllkdstrteivkavld

Sequence, based on observed residues (ATOM records): (download)

>d3euld_ c.23.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vvgddhplfregvvralslsgsvnvvgeaddpdvalldyrmpvllisahdqgaagfllkd
strteivkavld

SCOPe Domain Coordinates for d3euld_:

Click to download the PDB-style file with coordinates for d3euld_.
(The format of our PDB-style files is described here.)

Timeline for d3euld_: