| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [225553] (2 PDB entries) |
| Domain d3eulb_: 3eul B: [209670] automated match to d3h1ga_ complexed with cl |
PDB Entry: 3eul (more details), 1.9 Å
SCOPe Domain Sequences for d3eulb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eulb_ c.23.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pekvrvvvgddhplfregvvralslsgsvnvvgeaddgaaalelikahlpdvalldyrmp
gmdgaqvaaavrsyelptrvllisahdepaivyqalqqgaagfllkdstrteivkavldc
akgr
Timeline for d3eulb_: