Lineage for d1fveb2 (1fve B:121-223)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453271Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 453327Domain d1fveb2: 1fve B:121-223 [20967]
    Other proteins in same PDB: d1fvea1, d1fvea2, d1fveb1, d1fvec1, d1fvec2, d1fved1

Details for d1fveb2

PDB Entry: 1fve (more details), 2.7 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fveb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fveb2 b.1.1.2 (B:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1fveb2:

Click to download the PDB-style file with coordinates for d1fveb2.
(The format of our PDB-style files is described here.)

Timeline for d1fveb2: