SCOP 1.61: Domain d1fveb2: 1fve B:121-223

Lineage for d1fveb2 (1fve B:121-223)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
Species Fab 4D5 (synthetic, humanised version), kappa L chain [48992] (2 PDB entries)
Domain d1fveb2: 1fve B:121-223 [20967]
Other proteins in same PDB: d1fvea1, d1fveb1, d1fvec1, d1fved1

Details for d1fveb2

PDB Entry: 1fve (more details), 2.7 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fveb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fveb2 b.1.1.2 (B:121-223) Immunoglobulin (constant domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1fveb2:

Click to download the PDB-style file with coordinates for d1fveb2.
(The format of our PDB-style files is described here.)

Timeline for d1fveb2: