Lineage for d3eu9a1 (3eu9 A:51-281)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563231Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2563232Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2563379Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 2563380Protein automated matches [191267] (7 species)
    not a true protein
  7. 2563396Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)
  8. 2563420Domain d3eu9a1: 3eu9 A:51-281 [209666]
    Other proteins in same PDB: d3eu9a2
    automated match to d2dznc_
    complexed with gol, his, so4

Details for d3eu9a1

PDB Entry: 3eu9 (more details), 1.99 Å

PDB Description: The ankyrin repeat domain of Huntingtin interacting protein 14
PDB Compounds: (A:) Huntingtin-interacting protein 14

SCOPe Domain Sequences for d3eu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eu9a1 d.211.1.0 (A:51-281) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thiddystwdivkatqygiyercrelveagydvrqpdkenvtllhwaainnridlvkyyi
skgaivdqlggdlnstplhwatrqghlsmvvqlmkygadpslidgegcscihlaaqfght
sivayliakgqdvdmmdqngmtplmwaayrthsvdptrllltfnvsvnlgdkyhkntalh
wavlagnttvisllleaganvdaqnikgesaldlakqrknvwminhlqear

SCOPe Domain Coordinates for d3eu9a1:

Click to download the PDB-style file with coordinates for d3eu9a1.
(The format of our PDB-style files is described here.)

Timeline for d3eu9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eu9a2