| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.4.0: automated matches [227240] (1 protein) not a true family |
| Protein automated matches [227003] (2 species) not a true protein |
| Species Methanococcus maripaludis [TaxId:39152] [225662] (3 PDB entries) |
| Domain d3etla1: 3etl A:2-63 [209663] Other proteins in same PDB: d3etla2 automated match to d1pzna1 protein/DNA complex; complexed with anp, mg |
PDB Entry: 3etl (more details), 2.4 Å
SCOPe Domain Sequences for d3etla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etla1 a.60.4.0 (A:2-63) automated matches {Methanococcus maripaludis [TaxId: 39152]}
advltelpgvgpstadklieggyldfmkiatatigeltdiegisekaaakmimaardlcd
lg
Timeline for d3etla1: