![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fab 4D5 (synthetic, humanised version), kappa L chain [48992] (2 PDB entries) |
![]() | Domain d1fvea2: 1fve A:109-214 [20966] Other proteins in same PDB: d1fvea1, d1fveb1, d1fvec1, d1fved1 |
PDB Entry: 1fve (more details), 2.7 Å
SCOP Domain Sequences for d1fvea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvea2 b.1.1.2 (A:109-214) Immunoglobulin (constant domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain} tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1fvea2: