Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
Protein automated matches [227004] (3 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [225673] (5 PDB entries) |
Domain d3etge1: 3etg E:1-208 [209659] Other proteins in same PDB: d3etga2, d3etgb2, d3etgc2, d3etgd2, d3etge2, d3etgf2 automated match to d1l1fa2 complexed with glu, gtp, gwd, ndp |
PDB Entry: 3etg (more details), 2.5 Å
SCOPe Domain Sequences for d3etge1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etge1 c.58.1.1 (E:1-208) automated matches {Cow (Bos taurus) [TaxId: 9913]} adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia dtyastighydinahacvtgkpisqggi
Timeline for d3etge1: