Lineage for d3etgb2 (3etg B:209-501)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349489Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 1349768Protein automated matches [227005] (2 species)
    not a true protein
  7. 1349769Species Cow (Bos taurus) [TaxId:9913] [225674] (2 PDB entries)
  8. 1349777Domain d3etgb2: 3etg B:209-501 [209654]
    Other proteins in same PDB: d3etga1, d3etgb1, d3etgc1, d3etgd1, d3etge1, d3etgf1
    automated match to d1nr7a1
    complexed with glu, gtp, gwd, ndp

Details for d3etgb2

PDB Entry: 3etg (more details), 2.5 Å

PDB Description: glutamate dehydrogenase complexed with gw5074
PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etgb2 c.2.1.7 (B:209-501) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOPe Domain Coordinates for d3etgb2:

Click to download the PDB-style file with coordinates for d3etgb2.
(The format of our PDB-style files is described here.)

Timeline for d3etgb2: