SCOPe 2.08: Domain d3etgb1: 3etg B:1-208

Lineage for d3etgb1 (3etg B:1-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein automated matches [227004] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225673] (5 PDB entries)

8. Domain d3etgb1: 3etg B:1-208 [209653]
   Other proteins in same PDB: d3etga2, d3etgb2, d3etgc2, d3etgd2, d3etge2, d3etgf2
   automated match to d1l1fa2
   complexed with glu, gtp, gwd, ndp

Details for d3etgb1

PDB Entry: 3etg, 2.5 Å

PDB Description: glutamate dehydrogenase complexed with gw5074

PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etgb1:

Sequence; same for both SEQRES and ATOM records:

>d3etgb1 c.58.1.1 (B:1-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

Timeline for d3etgb1:

• d3etgb1 first appeared in SCOPe 2.03
  
• d3etgb1 appears in SCOPe 2.07