Lineage for d1fvdd2 (1fvd D:121-223)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747676Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2747878Domain d1fvdd2: 1fvd D:121-223 [20965]
    Other proteins in same PDB: d1fvda1, d1fvda2, d1fvdb1, d1fvdc1, d1fvdc2, d1fvdd1
    part of humanized Fab 4D5, herceptin

Details for d1fvdd2

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
PDB Compounds: (D:) igg1-kappa 4d5 fab (heavy chain)

SCOPe Domain Sequences for d1fvdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvdd2 b.1.1.2 (D:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d1fvdd2:

Click to download the PDB-style file with coordinates for d1fvdd2.
(The format of our PDB-style files is described here.)

Timeline for d1fvdd2: