SCOPe 2.08: Domain d1fvdd2: 1fvd D:121-223

Lineage for d1fvdd2 (1fvd D:121-223)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1fvdd2: 1fvd D:121-223 [20965]
   Other proteins in same PDB: d1fvda1, d1fvda2, d1fvdb1, d1fvdc1, d1fvdc2, d1fvdd1
   part of humanized Fab 4D5, herceptin

Details for d1fvdd2

PDB Entry: 1fvd, 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

PDB Compounds: (D:) igg1-kappa 4d5 fab (heavy chain)

SCOPe Domain Sequences for d1fvdd2:

Sequence; same for both SEQRES and ATOM records:

>d1fvdd2 b.1.1.2 (D:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1fvdd2:

• d1fvdd2 first appeared (with stable ids) in SCOP 1.55
  
• d1fvdd2 appears in SCOPe 2.07