SCOPe 2.08: Domain d3etde1: 3etd E:1-208

Lineage for d3etde1 (3etd E:1-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
   dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet

6. Protein automated matches [227004] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225673] (5 PDB entries)

8. Domain d3etde1: 3etd E:1-208 [209647]
   Other proteins in same PDB: d3etda2, d3etdb2, d3etdc2, d3etdd2, d3etde2, d3etdf2
   automated match to d1l1fa2
   complexed with b1t, glu, gtp, ndp

Details for d3etde1

PDB Entry: 3etd, 2.5 Å

PDB Description: structure of glutamate dehydrogenase complexed with bithionol

PDB Compounds: (E:) GLUD1 protein

SCOPe Domain Sequences for d3etde1:

Sequence; same for both SEQRES and ATOM records:

>d3etde1 c.58.1.1 (E:1-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

Timeline for d3etde1:

• d3etde1 first appeared in SCOPe 2.03
  
• d3etde1 appears in SCOPe 2.07