Lineage for d3etdd2 (3etd D:209-501)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453840Protein automated matches [227005] (6 species)
    not a true protein
  7. 2453841Species Cow (Bos taurus) [TaxId:9913] [225674] (6 PDB entries)
  8. 2453851Domain d3etdd2: 3etd D:209-501 [209646]
    Other proteins in same PDB: d3etda1, d3etdb1, d3etdc1, d3etdd1, d3etde1, d3etdf1
    automated match to d1nr7a1
    complexed with b1t, glu, gtp, ndp

Details for d3etdd2

PDB Entry: 3etd (more details), 2.5 Å

PDB Description: structure of glutamate dehydrogenase complexed with bithionol
PDB Compounds: (D:) GLUD1 protein

SCOPe Domain Sequences for d3etdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etdd2 c.2.1.7 (D:209-501) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOPe Domain Coordinates for d3etdd2:

Click to download the PDB-style file with coordinates for d3etdd2.
(The format of our PDB-style files is described here.)

Timeline for d3etdd2: