![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein automated matches [227005] (6 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [225674] (6 PDB entries) |
![]() | Domain d3etdd2: 3etd D:209-501 [209646] Other proteins in same PDB: d3etda1, d3etdb1, d3etdc1, d3etdd1, d3etde1, d3etdf1 automated match to d1nr7a1 complexed with b1t, glu, gtp, ndp |
PDB Entry: 3etd (more details), 2.5 Å
SCOPe Domain Sequences for d3etdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etdd2 c.2.1.7 (D:209-501) automated matches {Cow (Bos taurus) [TaxId: 9913]} hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
Timeline for d3etdd2: