SCOPe 2.05: Domain d3esvg1: 3esv G:-1-106

Lineage for d3esvg1 (3esv G:-1-106)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3esvg1: 3esv G:-1-106 [209633]
   automated match to d1h8na1

Details for d3esvg1

PDB Entry: 3esv, 2 Å

PDB Description: crystal structure of the engineered neutralizing antibody m18

PDB Compounds: (G:) Antibody M18 light chain and antibody M18 heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3esvg1:

Sequence; same for both SEQRES and ATOM records:

>d3esvg1 b.1.1.0 (G:-1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ykdiqmtqttsslsaslgdrvtvscrasqdirnylnwyqqkpdgtvkfliyytsrlqpgv
psrfsgsgsgtdysltinnleqedigtyfcqqgntppwtfgggtklei

Timeline for d3esvg1:

• d3esvg1 first appeared in SCOPe 2.03
  
• d3esvg1 appears in SCOPe 2.04
  
• d3esvg1 appears in SCOPe 2.06
  
• d3esvg1 appears in the current release, SCOPe 2.08