Lineage for d3esvf1 (3esv F:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760067Domain d3esvf1: 3esv F:1-106 [209631]
    Other proteins in same PDB: d3esvf3, d3esvg3
    automated match to d1h8na1

Details for d3esvf1

PDB Entry: 3esv (more details), 2 Å

PDB Description: crystal structure of the engineered neutralizing antibody m18
PDB Compounds: (F:) Antibody M18 light chain and antibody M18 heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3esvf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esvf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtvscrasqdirnylnwyqqkpdgtvkfliyytsrlqpgvps
rfsgsgsgtdysltinnleqedigtyfcqqgntppwtfgggtklei

SCOPe Domain Coordinates for d3esvf1:

Click to download the PDB-style file with coordinates for d3esvf1.
(The format of our PDB-style files is described here.)

Timeline for d3esvf1: