SCOPe 2.08: Domain d3esuf2: 3esu F:1004-1113

Lineage for d3esuf2 (3esu F:1004-1113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3esuf2: 3esu F:1004-1113 [209630]
   automated match to d1h8na2

Details for d3esuf2

PDB Entry: 3esu, 1.3 Å

PDB Description: crystal structure of anthrax-neutralizing single-chain antibody 14b7

PDB Compounds: (F:) Antibody 14b7* light chain and antibody 14b7* heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3esuf2:

Sequence; same for both SEQRES and ATOM records:

>d3esuf2 b.1.1.0 (F:1004-1113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lqqsgpelvkpgasvkisckdsgyafssswmnwvkqrpgqgpewigriypgdgdtnyngk
fkgkatltadkssstaymqlssltsvdsavyfcarsgllryamdywgqgtsvtvss

Timeline for d3esuf2:

• d3esuf2 first appeared in SCOPe 2.03
  
• d3esuf2 appears in SCOPe 2.07