Lineage for d1fvdb2 (1fvd B:121-223)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53570Species Fab 4D5 (synthetic, humanised version), kappa L chain [48992] (2 PDB entries)
  8. 53572Domain d1fvdb2: 1fvd B:121-223 [20963]
    Other proteins in same PDB: d1fvda1, d1fvdb1, d1fvdc1, d1fvdd1

Details for d1fvdb2

PDB Entry: 1fvd (more details), 2.5 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling

SCOP Domain Sequences for d1fvdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvdb2 b.1.1.2 (B:121-223) Immunoglobulin (constant domains of L and H chains) {Fab 4D5 (synthetic, humanised version), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1fvdb2:

Click to download the PDB-style file with coordinates for d1fvdb2.
(The format of our PDB-style files is described here.)

Timeline for d1fvdb2: