Lineage for d3esuf1 (3esu F:1-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520472Domain d3esuf1: 3esu F:1-106 [209629]
    automated match to d1h8na1

Details for d3esuf1

PDB Entry: 3esu (more details), 1.3 Å

PDB Description: crystal structure of anthrax-neutralizing single-chain antibody 14b7
PDB Compounds: (F:) Antibody 14b7* light chain and antibody 14b7* heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3esuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esuf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divliqstsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlqsgvps
rfsgsgsgtdysltisnleqedigtyfcqqgntlpwtfgggtklei

SCOPe Domain Coordinates for d3esuf1:

Click to download the PDB-style file with coordinates for d3esuf1.
(The format of our PDB-style files is described here.)

Timeline for d3esuf1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3esuf2