SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3esuf1 (3esu F:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (24 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (514 PDB entries)
  8. 2028405Domain d3esuf1: 3esu F:1-106 [209629]
    automated match to d1h8na1

Details for d3esuf1

PDB Entry: 3esu (more details), 1.3 Å

PDB Description: Crystal structure of anthrax-neutralizing single-chain antibody 14b7
PDB Compounds: (F:) Antibody 14b7* light chain and antibody 14b7* heavy chain linked with a synthetic (GGGGS)4 linker

SCOPe Domain Sequences for d3esuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esuf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divliqstsslsaslgdrvtiscrasqdirnylnwyqqkpdgtvklliyytsrlqsgvps
rfsgsgsgtdysltisnleqedigtyfcqqgntlpwtfgggtklei

SCOPe Domain Coordinates for d3esuf1:

Click to download the PDB-style file with coordinates for d3esuf1.
(The format of our PDB-style files is described here.)

Timeline for d3esuf1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3esuf2