Lineage for d3esfd2 (3esf D:86-197)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411726Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1411727Protein automated matches [226860] (25 species)
    not a true protein
  7. 1411847Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225661] (1 PDB entry)
  8. 1411851Domain d3esfd2: 3esf D:86-197 [209627]
    Other proteins in same PDB: d3esfa1, d3esfb1, d3esfc1, d3esfd1
    automated match to d1jr9a2
    complexed with fe

Details for d3esfd2

PDB Entry: 3esf (more details), 2.01 Å

PDB Description: crystal structure of the enzyme fe-superoxide dismutase tbsodb2 from trypanosoma brucei
PDB Compounds: (D:) Iron-containing superoxide dismutase B2

SCOPe Domain Sequences for d3esfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esfd2 d.44.1.0 (D:86-197) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ngggepsgklaeairasfgsfakfkeeftnaavghfgsgwawlvqdtttkklkvfqthda
gcplteadlkpiltcdvwehayyidykndrpayvqtfwnvvnwdhaenqftr

SCOPe Domain Coordinates for d3esfd2:

Click to download the PDB-style file with coordinates for d3esfd2.
(The format of our PDB-style files is described here.)

Timeline for d3esfd2: