SCOPe 2.08: Domain d3esfd2: 3esf D:86-197

Lineage for d3esfd2 (3esf D:86-197)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225661] (1 PDB entry)

8. Domain d3esfd2: 3esf D:86-197 [209627]
   Other proteins in same PDB: d3esfa1, d3esfb1, d3esfc1, d3esfd1
   automated match to d1jr9a2
   complexed with fe

Details for d3esfd2

PDB Entry: 3esf, 2.01 Å

PDB Description: crystal structure of the enzyme fe-superoxide dismutase tbsodb2 from trypanosoma brucei

PDB Compounds: (D:) Iron-containing superoxide dismutase B2

SCOPe Domain Sequences for d3esfd2:

Sequence; same for both SEQRES and ATOM records:

>d3esfd2 d.44.1.0 (D:86-197) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ngggepsgklaeairasfgsfakfkeeftnaavghfgsgwawlvqdtttkklkvfqthda
gcplteadlkpiltcdvwehayyidykndrpayvqtfwnvvnwdhaenqftr

Timeline for d3esfd2:

• d3esfd2 first appeared in SCOPe 2.03
  
• d3esfd2 appears in SCOPe 2.07