| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225660] (1 PDB entry) |
| Domain d3esfd1: 3esf D:1-85 [209626] Other proteins in same PDB: d3esfa2, d3esfb2, d3esfc2, d3esfd2 automated match to d1jr9a1 complexed with fe |
PDB Entry: 3esf (more details), 2.01 Å
SCOPe Domain Sequences for d3esfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3esfd1 a.2.11.0 (D:1-85) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mafsipplpwgydglaakgiskeqvtfhydkhhmgyvtklnaaansnpalaaksveeiir
tekgpifnlaaqifnhnfywesmsp
Timeline for d3esfd1: