Lineage for d3esfc2 (3esf C:86-197)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946564Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225661] (1 PDB entry)
  8. 2946567Domain d3esfc2: 3esf C:86-197 [209625]
    Other proteins in same PDB: d3esfa1, d3esfb1, d3esfc1, d3esfd1
    automated match to d1jr9a2
    complexed with fe

Details for d3esfc2

PDB Entry: 3esf (more details), 2.01 Å

PDB Description: crystal structure of the enzyme fe-superoxide dismutase tbsodb2 from trypanosoma brucei
PDB Compounds: (C:) Iron-containing superoxide dismutase B2

SCOPe Domain Sequences for d3esfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esfc2 d.44.1.0 (C:86-197) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ngggepsgklaeairasfgsfakfkeeftnaavghfgsgwawlvqdtttkklkvfqthda
gcplteadlkpiltcdvwehayyidykndrpayvqtfwnvvnwdhaenqftr

SCOPe Domain Coordinates for d3esfc2:

Click to download the PDB-style file with coordinates for d3esfc2.
(The format of our PDB-style files is described here.)

Timeline for d3esfc2: