SCOPe 2.06: Domain d3esfb1: 3esf B:1-85

Lineage for d3esfb1 (3esf B:1-85)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (32 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225660] (1 PDB entry)

8. Domain d3esfb1: 3esf B:1-85 [209622]
   Other proteins in same PDB: d3esfa2, d3esfb2, d3esfc2, d3esfd2
   automated match to d1jr9a1
   complexed with fe

Details for d3esfb1

PDB Entry: 3esf, 2.01 Å

PDB Description: crystal structure of the enzyme fe-superoxide dismutase tbsodb2 from trypanosoma brucei

PDB Compounds: (B:) Iron-containing superoxide dismutase B2

SCOPe Domain Sequences for d3esfb1:

Sequence; same for both SEQRES and ATOM records:

>d3esfb1 a.2.11.0 (B:1-85) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mafsipplpwgydglaakgiskeqvtfhydkhhmgyvtklnaaansnpalaaksveeiir
tekgpifnlaaqifnhnfywesmsp

Timeline for d3esfb1:

• d3esfb1 first appeared in SCOPe 2.03
  
• d3esfb1 appears in SCOPe 2.05
  
• d3esfb1 appears in SCOPe 2.07
  
• d3esfb1 appears in the current release, SCOPe 2.08