Lineage for d3esfa1 (3esf A:1-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690611Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225660] (1 PDB entry)
  8. 2690612Domain d3esfa1: 3esf A:1-85 [209620]
    Other proteins in same PDB: d3esfa2, d3esfb2, d3esfc2, d3esfd2
    automated match to d1jr9a1
    complexed with fe

Details for d3esfa1

PDB Entry: 3esf (more details), 2.01 Å

PDB Description: crystal structure of the enzyme fe-superoxide dismutase tbsodb2 from trypanosoma brucei
PDB Compounds: (A:) Iron-containing superoxide dismutase B2

SCOPe Domain Sequences for d3esfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esfa1 a.2.11.0 (A:1-85) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mafsipplpwgydglaakgiskeqvtfhydkhhmgyvtklnaaansnpalaaksveeiir
tekgpifnlaaqifnhnfywesmsp

SCOPe Domain Coordinates for d3esfa1:

Click to download the PDB-style file with coordinates for d3esfa1.
(The format of our PDB-style files is described here.)

Timeline for d3esfa1: