Lineage for d3erpb_ (3erp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081476Species Salmonella enterica [TaxId:99287] [225546] (2 PDB entries)
  8. 2081478Domain d3erpb_: 3erp B: [209619]
    automated match to d3n6qa_
    complexed with cac, cl, edo, na, zn

Details for d3erpb_

PDB Entry: 3erp (more details), 1.55 Å

PDB Description: structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium
PDB Compounds: (B:) Putative oxidoreductase

SCOPe Domain Sequences for d3erpb_:

Sequence, based on SEQRES records: (download)

>d3erpb_ c.1.7.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
iyqpdenryhtmeyrrcgrsgvklpaislglwhnfgdttrvensrallqrafdlgithfd
lannygpppgsaecnfgrilqedflpwrdeliistkagytmwdgpygdwgsrkyliasld
qslkrmgleyvdifyhhrpdpetplketmkaldhlvrhgkalyvgisnypadlarqaidi
ledlgtpclihqpkyslferwvedgllallqekgvgsiafsplaggqltdrylngipeds
raasgsrflkpeqitadklekvrrlnelaarrgqklsqmalawvlrndnvtsvligaskp
sqiedavgmlanrrfsaaecaeidailegr

Sequence, based on observed residues (ATOM records): (download)

>d3erpb_ c.1.7.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
iyqpdenryhtmeyrrcgrsgvklpaislglwhnfgdttrvensrallqrafdlgithfd
lannygpppgsaecnfgrilqedflpwrdeliistkagytmwdgpygdwgsrkyliasld
qslkrmgleyvdifyhhrpdpetplketmkaldhlvrhgkalyvgisnypadlarqaidi
ledlgtpclihqpkyslferwvedgllallqekgvgsiafsplaggqltdrydklekvrr
lnelaarrgqklsqmalawvlrndnvtsvligaskpsqiedavgmlanrrfsaaecaeid
ailegr

SCOPe Domain Coordinates for d3erpb_:

Click to download the PDB-style file with coordinates for d3erpb_.
(The format of our PDB-style files is described here.)

Timeline for d3erpb_: