Lineage for d3eq8a2 (3eq8 A:431-710)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151149Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins)
    N-terminal domain is a 7-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2151150Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)
  7. 2151151Species Pig (Sus scrofa) [TaxId:9823] [53498] (27 PDB entries)
    Uniprot P23687
  8. 2151177Domain d3eq8a2: 3eq8 A:431-710 [209605]
    Other proteins in same PDB: d3eq8a1
    automated match to d1qfma2
    complexed with x98

Details for d3eq8a2

PDB Entry: 3eq8 (more details), 2.73 Å

PDB Description: prolyl oligopeptidase complexed with r-pro-(decarboxy-pro)-type inhibitors
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3eq8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eq8a2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

SCOPe Domain Coordinates for d3eq8a2:

Click to download the PDB-style file with coordinates for d3eq8a2.
(The format of our PDB-style files is described here.)

Timeline for d3eq8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eq8a1