Lineage for d3eq8a1 (3eq8 A:2-430)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066278Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2066279Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)
  7. 2066280Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
    Uniprot P23687
  8. 2066306Domain d3eq8a1: 3eq8 A:2-430 [209604]
    Other proteins in same PDB: d3eq8a2
    automated match to d1qfma1
    complexed with x98

Details for d3eq8a1

PDB Entry: 3eq8 (more details), 2.73 Å

PDB Description: prolyl oligopeptidase complexed with r-pro-(decarboxy-pro)-type inhibitors
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d3eq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eq8a1 b.69.7.1 (A:2-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
lsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpirg
lykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnilsd
dgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawthd
gkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggaels
ddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvft
fktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvkntl
qlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeeleprv
frevtvkgi

SCOPe Domain Coordinates for d3eq8a1:

Click to download the PDB-style file with coordinates for d3eq8a1.
(The format of our PDB-style files is described here.)

Timeline for d3eq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3eq8a2