Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) |
Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 proteins) automatically mapped to Pfam PF02897 |
Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries) Uniprot P23687 |
Domain d3eq7a1: 3eq7 A:4-430 [209602] Other proteins in same PDB: d3eq7a2 automated match to d1qfma1 complexed with x99 |
PDB Entry: 3eq7 (more details), 2.89 Å
SCOPe Domain Sequences for d3eq7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eq7a1 b.69.7.1 (A:4-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} fqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpirgly kermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnilsddg tvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawthdgk gmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggaelsdd gryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvftfk tnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvkntlql hdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeeleprvfr evtvkgi
Timeline for d3eq7a1: