Lineage for d2mcpl2 (2mcp L:115-220)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289943Domain d2mcpl2: 2mcp L:115-220 [20960]
    Other proteins in same PDB: d2mcph1, d2mcph2, d2mcpl1
    part of Fab MCPC603
    complexed with pc

Details for d2mcpl2

PDB Entry: 2mcp (more details), 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution

SCOP Domain Sequences for d2mcpl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcpl2 b.1.1.2 (L:115-220) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2mcpl2:

Click to download the PDB-style file with coordinates for d2mcpl2.
(The format of our PDB-style files is described here.)

Timeline for d2mcpl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcpl1