Lineage for d3eq5g_ (3eq5 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696418Family a.6.1.4: Dachshund-homology domain [74693] (3 proteins)
    Pfam PF02437
  6. 2696426Protein automated matches [226994] (1 species)
    not a true protein
  7. 2696427Species Human (Homo sapiens) [TaxId:9606] [225602] (1 PDB entry)
  8. 2696434Domain d3eq5g_: 3eq5 G: [209596]
    Other proteins in same PDB: d3eq5a2
    automated match to d1sbxa_

Details for d3eq5g_

PDB Entry: 3eq5 (more details), 2.45 Å

PDB Description: Crystal structure of fragment 137 to 238 of the human Ski-like protein
PDB Compounds: (G:) Ski-like protein

SCOPe Domain Sequences for d3eq5g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eq5g_ a.6.1.4 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
steltqtvlegesiscfqvggekrlclpqvlnsvlreftlqqintvcdelyiycsrctsd
qlhilkvlgilpfnapscglitltdaqrlcnallr

SCOPe Domain Coordinates for d3eq5g_:

Click to download the PDB-style file with coordinates for d3eq5g_.
(The format of our PDB-style files is described here.)

Timeline for d3eq5g_: