| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
| Family a.6.1.4: Dachshund-homology domain [74693] (3 proteins) Pfam PF02437 |
| Protein automated matches [226994] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225602] (1 PDB entry) |
| Domain d3eq5e_: 3eq5 E: [209594] Other proteins in same PDB: d3eq5a2 automated match to d1sbxa_ |
PDB Entry: 3eq5 (more details), 2.45 Å
SCOPe Domain Sequences for d3eq5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eq5e_ a.6.1.4 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teltqtvlegesiscfqvggekrlclpqvlnsvlreftlqqintvcdelyiycsrctsdq
lhilkvlgilpfnapscglitltdaqrlcnallrp
Timeline for d3eq5e_: