Lineage for d3eonc1 (3eon C:4-242)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015678Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 3015701Domain d3eonc1: 3eon C:4-242 [209584]
    Other proteins in same PDB: d3eona2, d3eonb2, d3eonc2, d3eond2
    automated match to d1siqa2
    complexed with 341

Details for d3eonc1

PDB Entry: 3eon (more details), 2.55 Å

PDB Description: 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule
PDB Compounds: (C:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3eonc1:

Sequence, based on SEQRES records: (download)

>d3eonc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records): (download)

>d3eonc1 e.6.1.0 (C:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepgsmvtrarkvpggyslsgskmwitnspiadvfvvwakldedg
rdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3eonc1:

Click to download the PDB-style file with coordinates for d3eonc1.
(The format of our PDB-style files is described here.)

Timeline for d3eonc1: