Lineage for d1mcpl2 (1mcp L:115-220)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656428Domain d1mcpl2: 1mcp L:115-220 [20958]
    Other proteins in same PDB: d1mcph1, d1mcph2, d1mcpl1
    part of Fab MCPC603
    complexed with so4

Details for d1mcpl2

PDB Entry: 1mcp (more details), 2.7 Å

PDB Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms
PDB Compounds: (L:) iga-kappa mcpc603 fab (light chain)

SCOP Domain Sequences for d1mcpl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcpl2 b.1.1.2 (L:115-220) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1mcpl2:

Click to download the PDB-style file with coordinates for d1mcpl2.
(The format of our PDB-style files is described here.)

Timeline for d1mcpl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcpl1