SCOP 1.61: Domain d1mcpl2: 1mcp L:115-220

Lineage for d1mcpl2 (1mcp L:115-220)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab MCPC603 (human), kappa L chain [48991] (2 PDB entries)

8. Domain d1mcpl2: 1mcp L:115-220 [20958]
   Other proteins in same PDB: d1mcph1, d1mcpl1

Details for d1mcpl2

PDB Entry: 1mcp, 2.7 Å

PDB Description: phosphocholine binding immunoglobulin fab mc/pc603. an x-ray diffraction study at 2.7 angstroms

SCOP Domain Sequences for d1mcpl2:

Sequence; same for both SEQRES and ATOM records:

>d1mcpl2 b.1.1.2 (L:115-220) Immunoglobulin (constant domains of L and H chains) {Fab MCPC603 (human), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1mcpl2:

• d1mcpl2 first appeared (with stable ids) in SCOP 1.55
  
• d1mcpl2 appears in SCOP 1.59
  
• d1mcpl2 appears in SCOP 1.63
  
• d1mcpl2 appears in the current release, SCOPe 2.08