Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab MCPC603 (human), kappa L chain [48991] (2 PDB entries) |
Domain d1mcpl2: 1mcp L:115-220 [20958] Other proteins in same PDB: d1mcph1, d1mcpl1 |
PDB Entry: 1mcp (more details), 2.7 Å
SCOP Domain Sequences for d1mcpl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcpl2 b.1.1.2 (L:115-220) Immunoglobulin (constant domains of L and H chains) {Fab MCPC603 (human), kappa L chain} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1mcpl2: