![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
![]() | Protein automated matches [226934] (29 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries) |
![]() | Domain d3eomd1: 3eom D:3-242 [209578] Other proteins in same PDB: d3eoma2, d3eomb2, d3eomc2, d3eomd2 automated match to d1siqa2 |
PDB Entry: 3eom (more details), 2.4 Å
SCOPe Domain Sequences for d3eomd1:
Sequence, based on SEQRES records: (download)
>d3eomd1 e.6.1.0 (D:3-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]} aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek ylpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvw akldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg
>d3eomd1 e.6.1.0 (D:3-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]} aatfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeig llgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkek ylpklatgewigcfgltepsmvtrarkvpggyslsgskmwitnspiadvfvvwaklddgr deirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg
Timeline for d3eomd1: