Lineage for d3eoma2 (3eom A:243-395)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992885Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1993019Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1993020Protein automated matches [226935] (26 species)
    not a true protein
  7. 1993051Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries)
  8. 1993068Domain d3eoma2: 3eom A:243-395 [209573]
    Other proteins in same PDB: d3eoma1, d3eomb1, d3eomc1, d3eomd1
    automated match to d1siqa1

Details for d3eoma2

PDB Entry: 3eom (more details), 2.4 Å

PDB Description: 2.4 a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3eoma2:

Sequence, based on SEQRES records: (download)

>d3eoma2 a.29.3.0 (A:243-395) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyegthdihalilgraqtgiqaff

Sequence, based on observed residues (ATOM records): (download)

>d3eoma2 a.29.3.0 (A:243-395) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngsdefgvarh
lvnlevvntyegthdihalilgraqtgiqaff

SCOPe Domain Coordinates for d3eoma2:

Click to download the PDB-style file with coordinates for d3eoma2.
(The format of our PDB-style files is described here.)

Timeline for d3eoma2: