SCOPe 2.08: Domain d3eoda_: 3eod A:

Lineage for d3eoda_ (3eod A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225766] (2 PDB entries)

8. Domain d3eoda_: 3eod A: [209571]
   automated match to d1peyc_

Details for d3eoda_

PDB Entry: 3eod, 1.75 Å

PDB Description: crystal structure of n-terminal domain of e. coli rssb

PDB Compounds: (A:) Protein hnr

SCOPe Domain Sequences for d3eoda_:

Sequence, based on SEQRES records:

>d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiamp
rmnglkllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvkdlnrlremvfa
cly

Sequence, based on observed residues (ATOM records):

>d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qplvgkqilivedeqvfrslldswfsslgattvlaadgvdalellggftpdlmicdiagl
kllehirnrgdqtpvlvisatenmadiakalrlgvedvllkpvnrlremvfacly

Timeline for d3eoda_:

• d3eoda_ first appeared in SCOPe 2.03
  
• d3eoda_ appears in SCOPe 2.07